Vasoactive Intestinal Peptide Sourcing Guide Purity Specifications Manufacturing Certifications for Lab Formulations

Core Molecular Specs & Technical Index

Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide belonging to the glucagon/secretin superfamily. For B2B buyers in cosmetic formulation and laboratory research, the molecule presents a unique combination of signaling properties and structural complexity. The peptide sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, with a molecular weight of approximately 3326.8 Da. This amphipathic structure enables interaction with both aqueous and lipid environments, making it a versatile raw material for advanced formulations.

When sourcing vasoactive intestinal peptide for lab or commercial use, five technical parameters are non-negotiable:

• Purity threshold: Minimum 98% by HPLC, with premium grades reaching 99.5% for research applications.
• Solubility profile: Fully soluble in water at 1 mg/mL, with optimal reconstitution in sterile PBS or acetic acid solutions.
• Storage stability: Lyophilized powder remains stable for 24 months at -20°C; reconstituted solutions must be used within 72 hours at 4°C.
• Endotoxin levels: Below 0.5 EU/mg for cosmetic use, under 0.1 EU/mg for cell culture applications.
• Peptide content: Typically 70-85% net peptide weight, with the remainder being counterions and water.

Industry data from the Peptide Therapeutics Foundation indicates that 92% of failed peptide formulations trace back to substandard purity or improper storage conditions. For vasoactive intestinal peptide, maintaining a strict -20°C cold chain from manufacturing to formulation is the single most critical quality control point.

Manufacturing & Quality Control

The production of high-grade vasoactive intestinal peptide follows a rigorous multi-step process that separates premium suppliers from commodity traders. Solid-phase peptide synthesis (SPPS) using Fmoc chemistry remains the industry standard, with each amino acid coupling step monitored by Kaiser test and HPLC analysis. After cleavage from the resin, the crude peptide undergoes preparative reverse-phase HPLC purification, achieving the required purity through gradient elution with acetonitrile and water.

Quality control for vasoactive intestinal peptide involves three distinct verification layers:

• Identity confirmation: Mass spectrometry (MALDI-TOF or ESI-MS) must match the theoretical molecular weight within 0.5 Da.
• Purity verification: Analytical HPLC with UV detection at 214 nm and 280 nm, plus capillary electrophoresis for charged variants.
• Bioactivity testing: Cell-based cAMP accumulation assay using VIP receptor-expressing cell lines, with activity reported as EC50 relative to reference standard.

Certifications that distinguish professional-grade vasoactive intestinal peptide suppliers include:

• ISO 9001:2015 for quality management systems in peptide manufacturing.
• GMP certification for cosmetic raw material production (ISO 22716).
• Third-party Certificate of Analysis (CoA) with batch-specific HPLC and MS data.
• Material Safety Data Sheet (MSDS) compliant with GHS classification.
• Stability study reports covering 12-24 months under recommended storage conditions.

Commercial Application Scenarios

Vasoactive intestinal peptide serves distinct roles across three primary B2B channels. In cosmetic formulation, the peptide is incorporated into anti-aging serums and eye creams at concentrations between 0.01% and 0.1%. Its ability to modulate dermal fibroblast activity makes it a premium ingredient for products targeting skin firmness and texture refinement. Formulators typically combine VIP with stabilizing agents like trehalose or cyclodextrins to maintain peptide integrity in aqueous formulations.

For laboratory research, vasoactive intestinal peptide is used in neurobiology and immunology studies at concentrations ranging from 10 nM to 1 µM. Researchers require consistent batch-to-batch purity and documented bioactivity data to ensure reproducible results. Bulk orders for academic institutions often include custom aliquoting and lyophilization services to minimize freeze-thaw cycles.

Bulk wholesale buyers in the pharmaceutical intermediates sector purchase vasoactive intestinal peptide in gram-to-kilogram quantities. These transactions demand full documentation including manufacturing records, stability data, and regulatory compliance statements. Lead times for large-scale production typically range from 4 to 8 weeks, depending on purity requirements and order volume.

Vasoactive Intestinal Peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

Procuring vasoactive intestinal peptide for commercial or research applications requires careful supplier evaluation to avoid common pitfalls. The first red flag is pricing significantly below market average—authentic high-purity VIP typically costs between $50 and $200 per milligram for research quantities, with bulk discounts reducing per-gram pricing to $5,000-$15,000 depending on volume and purity grade.

Selection standards for professional buyers include:

• Request batch-specific documentation: Demand the actual CoA for the batch you are purchasing, not a generic template.
• Verify analytical methods: Ensure HPLC conditions, column specifications, and detection wavelengths are clearly stated.
• Check storage and shipping: Confirm the supplier uses dry ice or validated cold chain packaging for international shipments.
• Review stability data: Ask for accelerated stability studies at 25°C and 40°C to predict real-world performance.
• Assess technical support: Reliable suppliers offer formulation guidance and troubleshooting for peptide handling issues.

A buyer checklist for vasoactive intestinal peptide procurement should include: purity specification, endotoxin limit, peptide content percentage, salt form (typically TFA or acetate), packaging format (lyophilized powder or pre-weighed aliquots), and lead time. For cosmetic applications, additionally verify that the supplier provides cosmetic-grade documentation and can support INCI name registration if needed.

Core Product Advantages

Professional-grade vasoactive intestinal peptide offers four distinct advantages over standard peptide raw materials. First, purity consistency across batches ensures that formulation scientists can replicate results without re-optimizing concentrations or processing conditions. Each batch is tested against a reference standard, with impurity profiles documented and controlled.

Second, enhanced stability through optimized lyophilization protocols and packaging under inert gas extends the usable shelf life. This reduces inventory costs for bulk buyers and minimizes the risk of degraded product arriving at formulation facilities. Third, cost performance is achieved through efficient synthesis routes that maintain high yield without compromising purity. Bulk pricing structures reward volume commitments, with tiered discounts for orders exceeding 10 grams.

Fourth, technical support from experienced peptide chemists helps buyers navigate formulation challenges. Whether the application is a water-based serum or a lipid-rich cream, suppliers with deep peptide expertise can recommend appropriate excipients, pH ranges, and processing conditions to maintain vasoactive intestinal peptide activity throughout the product lifecycle.

Frequently Asked Questions

Q: What is the minimum order quantity for vasoactive intestinal peptide in bulk?
A: Most professional suppliers require a minimum order of 100 mg for research-grade material and 1 gram for cosmetic-grade product. For pharmaceutical intermediate applications, minimums typically start at 5 grams. Custom synthesis for larger quantities is available with lead times of 4-8 weeks.

Q: How should vasoactive intestinal peptide be handled during formulation?
A: The lyophilized powder should be equilibrated to room temperature before opening to prevent moisture condensation. Reconstitute in sterile, endotoxin-free water or buffer at pH 5-6. Avoid repeated freeze-thaw cycles by aliquoting into single-use vials. For cosmetic formulations, incorporate the peptide at temperatures below 40°C to prevent thermal degradation.

Q: What documentation is required for regulatory compliance?
A: For cosmetic raw material import, you need a Certificate of Analysis with HPLC chromatogram, MS spectrum, and endotoxin test results. A Material Safety Data Sheet compliant with local regulations is mandatory. For research use, a Certificate of Origin and stability study summary are typically sufficient. Always verify specific requirements with your local regulatory authority before ordering.