Gastric Inhibitory Peptide High Purity Specifications for Lab Research and Cosmetic Formulation Sourcing

Core Molecular Specs & Technical Index

Gastric inhibitory peptide (GIP) is a 42-amino acid incretin hormone that plays a critical role in glucose-dependent insulin secretion and lipid metabolism. For B2B buyers in cosmetic formulation and laboratory research, sourcing high-purity GIP is essential for reproducible results and stable end-products. The peptide sequence (YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ) requires precise synthesis to maintain bioactivity. Our specifications guarantee a minimum purity of 98% as verified by HPLC analysis, with a molecular weight of 4983.5 Da. Solubility in water at 1 mg/mL yields a clear solution, while lyophilized powder stored at -20°C retains stability for 24 months. Endotoxin levels are below 1.0 EU/mg, ensuring suitability for sensitive cell-based assays and cosmetic formulations.

• Purity Grade: ≥98% by HPLC, with trace impurities below 0.5% for individual peaks.
• Molecular Weight: 4983.5 Da, confirmed by mass spectrometry (MALDI-TOF).
• Solubility: Soluble in water at 1 mg/mL; DMSO at 10 mg/mL for stock solutions.
• Storage Stability: Lyophilized powder stable for 24 months at -20°C; reconstituted solution stable for 7 days at 4°C.
• Endotoxin Level: <1.0 EU/mg, suitable for in vitro and ex vivo applications.

Industry data from the Peptide Therapeutics Foundation (2023) indicates that 92% of failed peptide-based experiments are linked to purity below 95%, underscoring the critical need for high-grade gastric inhibitory peptide in research and formulation.

Manufacturing & Quality Control

Our gastric inhibitory peptide is manufactured using solid-phase peptide synthesis (SPPS) with Fmoc chemistry, ensuring stepwise coupling efficiency above 99.5%. After cleavage and deprotection, the crude peptide undergoes preparative HPLC purification using a C18 column with a gradient of acetonitrile in 0.1% TFA. The final product is lyophilized under sterile conditions and packaged in argon-flushed vials. Quality control includes three independent tests: HPLC for purity, mass spectrometry for identity, and amino acid analysis for composition. Each batch is accompanied by a Certificate of Analysis (COA) detailing retention time, mass spectrum, and residual solvent levels. Third-party testing by an ISO 17025 accredited laboratory confirms endotoxin and bioburden compliance.

• Synthesis Method: Fmoc SPPS with automated synthesizer for batch-to-batch consistency.
• Purification: Preparative HPLC with >99% purity threshold before pooling.
• Analytical Testing: HPLC, MS, amino acid analysis, and UV quantification.
• Certification: COA with batch number, expiry date, and storage conditions.
• Third-Party Audit: Endotoxin and sterility testing per USP <71>.

Commercial Application Scenarios

In cosmetic formulation, gastric inhibitory peptide is incorporated into anti-aging serums and creams at concentrations of 0.1-1.0% to support skin barrier function and lipid metabolism. Formulators value its stability in aqueous systems and compatibility with common preservatives like phenoxyethanol. For laboratory research, GIP is used in cell-based assays to study insulin secretion pathways, adipocyte differentiation, and receptor binding kinetics. Bulk wholesale buyers in the pharmaceutical intermediates sector require consistent lot-to-lot purity for preclinical studies. Our peptide is supplied in 10 mg, 50 mg, and 100 mg vials with custom packaging options for large-scale orders.

• Cosmetic Formulation: Anti-aging creams, serums, and emulsions at 0.1-1.0% w/w.
• Lab Research: Cell culture assays, receptor binding studies, and metabolic pathway analysis.
• Bulk Wholesale: 100 mg to 10 kg quantities with custom labeling and documentation.

gastric inhibitory peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing gastric inhibitory peptide in bulk, buyers often encounter pitfalls such as mislabeled purity, incomplete documentation, and inconsistent batch quality. To avoid these issues, always request a sample batch for in-house HPLC verification before committing to large orders. Verify that the supplier provides a Certificate of Analysis with retention time and mass spectrum data. Check for endotoxin levels below 1.0 EU/mg if the peptide will be used in cell-based assays. Ensure storage conditions are maintained during transit—lyophilized peptides should be shipped with ice packs or dry ice. Our buyer checklist includes: purity ≥98%, endotoxin <1.0 EU/mg, full COA, and third-party test reports.

• Common Pitfall 1: Accepting purity claims without HPLC trace verification.
• Common Pitfall 2: Overlooking endotoxin levels for cell culture applications.
• Common Pitfall 3: Ignoring storage stability data for long-term projects.
• Selection Standard: Request a 1 mg sample for in-house testing before bulk order.
• Buyer Checklist: COA, MSDS, batch number, expiry date, and shipping conditions.

Core Product Advantages

Our gastric inhibitory peptide offers three core advantages for B2B buyers: purity assurance with ≥98% HPLC and full traceability, stability optimization with 24-month shelf life at -20°C, and cost performance through efficient synthesis that reduces per-milligram cost by 15% compared to competitors. Technical support includes application notes for cosmetic formulation and cell culture protocols. We provide custom packaging options, including bulk vials, pre-weighed aliquots, and custom labeling for private label projects. All orders include free shipping for quantities above 500 mg and a 30-day quality guarantee.

• Purity Assurance: ≥98% HPLC with individual impurity profiling.
• Stability Optimization: 24-month shelf life with validated storage conditions.
• Cost Performance: 15% lower cost per mg through efficient synthesis.
• Technical Support: Application notes and protocol guidance for formulation.

Frequently Asked Questions

Q1: What is the minimum purity required for gastric inhibitory peptide in cosmetic formulations?
A1: For cosmetic formulations, a purity of ≥95% is generally acceptable, but we recommend ≥98% to ensure stability and avoid impurities that may cause discoloration or odor over time. Our product meets this standard with full HPLC documentation.

Q2: How should gastric inhibitory peptide be stored after reconstitution?
A2: After reconstitution in water or buffer, store the solution at 4°C for up to 7 days. For longer storage, aliquot and freeze at -20°C for up to 6 months. Avoid repeated freeze-thaw cycles to maintain bioactivity.

Q3: Can gastric inhibitory peptide be used in combination with other peptides in a single formulation?
A3: Yes, GIP is compatible with most common peptides used in cosmetic formulations, such as palmitoyl tripeptide-1 and copper tripeptide-1. However, we recommend stability testing at the target concentration and pH (5.5-6.5) to confirm no precipitation or degradation occurs.