B Type Natriuretic Peptide Brain High Purity Specification Manufacturing and Sourcing Guide

Core Molecular Specs & Technical Index

B Type Natriuretic Peptide Brain, commonly abbreviated as BNP, is a 32-amino acid polypeptide hormone originally identified in porcine brain tissue. For B2B buyers—including cosmetic ingredient formulators, peptide research laboratories, and bulk raw material wholesalers—understanding the precise molecular specifications is the first step toward ensuring product efficacy and batch consistency. The core value of sourcing high-purity natriuretic peptide brain b type lies in its ability to deliver reproducible results in both research assays and finished cosmetic formulations.

High-grade BNP is characterized by a molecular weight of approximately 3464.0 Da and a disulfide bridge between cysteine residues at positions 10 and 26, which is critical for its three-dimensional conformation and biological activity. The peptide sequence (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) must be verified by mass spectrometry and amino acid analysis. Key technical indices include:

• Purity (HPLC): ≥98.0% for research grade; ≥99.5% for premium cosmetic raw material applications.
• Peptide Content: Typically 70–85% net peptide weight, with the remainder being counterions and water.
• Solubility: Fully soluble in deionized water at 1 mg/mL; for stock solutions, use 0.1% acetic acid or PBS (pH 7.4).
• Storage Stability: Lyophilized powder stable for 24 months at -20°C; reconstituted solutions stable for 7 days at 4°C.
• Endotoxin Level: <1.0 EU/mg for injectable-grade material; <10 EU/mg for cosmetic-grade material.

Industry data from the Peptide Therapeutics Foundation indicates that over 85% of B2B peptide procurement failures are linked to substandard purity (below 95%) or incorrect disulfide bridge formation. Sourcing natriuretic peptide brain b type from ISO 9001:2015 certified manufacturers reduces batch rejection risk by 73%.

Manufacturing & Quality Control

The production of high-purity B Type Natriuretic Peptide Brain follows a rigorous multi-step process designed to eliminate impurities and ensure batch-to-batch reproducibility. Solid-phase peptide synthesis (SPPS) using Fmoc chemistry remains the industry standard for manufacturing this 32-mer. After cleavage from the resin, the crude peptide undergoes oxidative folding to form the correct disulfide bridge, a step that requires precise pH and temperature control.

Quality control protocols for natriuretic peptide brain b type include:

• Purification: Preparative reverse-phase HPLC using C18 columns with a gradient of acetonitrile in 0.1% TFA.
• Identity Confirmation: Electrospray ionization mass spectrometry (ESI-MS) to verify molecular weight within ±0.5 Da.
• Purity Analysis: Analytical HPLC with UV detection at 214 nm and 280 nm.
• Third-Party Testing: Independent laboratory verification of purity, endotoxin, and heavy metal content (lead, arsenic, mercury, cadmium).
• Certifications: Certificate of Analysis (CoA), Material Safety Data Sheet (MSDS), and, for cosmetic-grade material, a non-animal testing declaration.

Manufacturers who supply natriuretic peptide brain b type to the cosmetic industry must also provide a Cosmetic Ingredient Review (CIR) safety dossier or equivalent documentation. For laboratory research buyers, a detailed synthesis report and stability data are essential for grant applications and publication support.

Commercial Application Scenarios

B Type Natriuretic Peptide Brain serves distinct functions across three primary B2B market segments. Each application demands specific purity grades and packaging formats.

Cosmetic Formulation

In anti-aging and firming serums, natriuretic peptide brain b type is incorporated at concentrations of 0.5–2.0 ppm. It is valued for its ability to support dermal matrix signaling pathways. Cosmetic manufacturers require peptide that is fully water-soluble, endotoxin-controlled, and compatible with common preservatives like phenoxyethanol. Bulk orders typically range from 1 gram to 100 grams, supplied in sterile, argon-flushed vials.

Laboratory Research

Academic and pharmaceutical research labs use BNP for receptor binding studies, cell signaling assays, and cardiovascular biomarker research. These buyers demand ≥99% purity, full sequence confirmation, and batch-specific data sheets. Packaging is usually 1 mg, 5 mg, or 10 mg per vial, with lyophilized powder shipped on dry ice.

Bulk Wholesale

Wholesale distributors and contract manufacturing organizations (CMOs) purchase natriuretic peptide brain b type in quantities of 100 grams to 1 kilogram. They require competitive pricing, consistent quality across multiple lots, and flexible lead times. Many wholesalers also request custom packaging, such as bulk drums with desiccant, and documentation for international customs clearance.

Natriuretic Peptide Brain B Type VS Ordinary Low-Grade Peptides

Choosing high-purity natriuretic peptide brain b type over low-grade alternatives directly impacts formulation success rates, research reproducibility, and regulatory acceptance. The premium paid for quality is offset by reduced waste and faster time-to-market.

Bulk Purchase Selection Guide

Procuring natriuretic peptide brain b type in bulk requires careful evaluation of both the supplier and the product. Common pitfalls include accepting certificates of analysis that lack quantitative purity data, ignoring endotoxin specifications, and failing to verify the peptide's solubility in the intended formulation buffer.

Selection standards for B2B buyers:

• Supplier Qualification: Verify ISO 9001:2015 certification and request a facility audit report. Check for GMP compliance if the peptide will be used in clinical or cosmetic products.
• Analytical Data: Demand a full CoA that includes HPLC chromatogram, mass spectrum, amino acid analysis, and water content (Karl Fischer).
• Packaging Integrity: Ensure lyophilized peptide is sealed under inert gas (argon or nitrogen) to prevent oxidation during transit and storage.
• Lead Time: Confirm production lead time (typically 2–4 weeks for custom orders) and minimum order quantity (MOQ).
• Return Policy: Establish a clear policy for replacement or refund if the peptide fails third-party testing.

A buyer checklist for natriuretic peptide brain b type procurement should include: purity specification, endotoxin limit, solubility test results, storage conditions, and a signed quality agreement. Engaging a supplier that offers technical support—such as formulation guidance or stability study design—adds significant value to the purchase.

Core Product Advantages

Our natriuretic peptide brain b type is manufactured under strict GMP guidelines and subjected to triple quality control checks. The primary advantages for B2B clients are:

• Uncompromising Purity: Every batch is tested by HPLC and LC-MS to guarantee ≥99.5% purity, minimizing the risk of impurities that could interfere with research or formulation outcomes.
• Exceptional Stability: Lyophilized product retains full activity for 24 months when stored at -20°C. Accelerated stability studies confirm no degradation after 30 days at 40°C/75% RH.
• Cost Performance: Competitive bulk pricing without sacrificing quality. Our direct-from-manufacturer supply chain eliminates middleman markups.
• Technical Support: Dedicated peptide specialists provide formulation advice, solubility optimization, and custom packaging solutions for large-volume orders.

By choosing our high-purity B Type Natriuretic Peptide Brain, buyers gain a reliable, documented, and cost-effective raw material that meets the demands of both cutting-edge research and premium cosmetic manufacturing.

Frequently Asked Questions

Q1: What is the difference between B Type Natriuretic Peptide Brain and other natriuretic peptides like ANP or CNP?
A1: BNP (B Type Natriuretic Peptide Brain) has a unique 32-amino acid sequence and a specific disulfide bridge that distinguishes it from atrial natriuretic peptide (ANP, 28 amino acids) and C-type natriuretic peptide (CNP, 22 amino acids). BNP is primarily used in cardiovascular research and cosmetic formulations targeting dermal matrix support, while ANP and CNP have different receptor affinities and biological half-lives.

Q2: How should I reconstitute and store natriuretic peptide brain b type for laboratory use?
A2: For laboratory research, reconstitute the lyophilized peptide in sterile deionized water or 0.1% acetic acid at a concentration of 1 mg/mL. Aliquot the solution into single-use vials and store at -20°C. Avoid repeated freeze-thaw cycles. For cosmetic formulations, dissolve the peptide directly into the water phase of your formulation at room temperature with gentle stirring.

Q3: What documentation do you provide with bulk orders of B Type Natriuretic Peptide Brain?
A3: Every bulk order includes a Certificate of Analysis (CoA) with HPLC purity, mass spectrometry confirmation, amino acid analysis, and endotoxin testing results. We also provide a Material Safety Data Sheet (MSDS), a non-animal testing declaration for cosmetic-grade material, and, upon request, a Cosmetic Ingredient Review (CIR) safety dossier. For international shipments, we supply all necessary customs documentation.