High B Type Natriuretic Peptide Sourcing Guide Purity Specifications Manufacturing Certifications

Core Molecular Specs & Technical Index

High B type natriuretic peptide (BNP) is a 32-amino acid neurohormone synthesized predominantly in the cardiac ventricles. For B2B buyers in cosmetic raw material and laboratory research sectors, sourcing high-purity BNP is critical for assay development, formulation testing, and biomarker studies. The core value lies in its specificity for cardiovascular research and its emerging role in dermal anti-aging applications. This guide provides technical specifications, manufacturing certifications, and procurement standards to ensure reliable sourcing.

• Molecular Weight: 3464.0 Da (calculated monoisotopic mass), with a sequence of SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
• Purity Grade: ≥98% by HPLC analysis, with endotoxin levels ≤1.0 EU/mg for research-grade material.
• Solubility: Fully soluble in water (≥10 mg/mL) and phosphate-buffered saline (PBS) at pH 7.4, with recommended reconstitution in 0.1% acetic acid for long-term stability.
• Storage Conditions: Lyophilized powder stable at -20°C for 24 months; reconstituted solution stable at -80°C for 6 months (avoid repeated freeze-thaw cycles).
• Biological Activity: BNP binds specifically to natriuretic peptide receptor-A (NPR-A), activating cGMP signaling pathways—validated via ELISA or cell-based assays.

Industry data from the Peptide Therapeutics Foundation (2024) indicates that high b type natriuretic peptide demand in cosmetic R&D grew 37% year-over-year, driven by its anti-inflammatory and extracellular matrix modulation properties. Over 80% of bulk buyers now require third-party HPLC and mass spectrometry (MS) certification for each batch.

Manufacturing & Quality Control

Production of high b type natriuretic peptide follows a multi-step solid-phase peptide synthesis (SPPS) process, ensuring batch-to-batch consistency. After synthesis, the crude peptide undergoes cleavage, precipitation, and lyophilization. Quality control includes reversed-phase HPLC for purity assessment, electrospray ionization mass spectrometry (ESI-MS) for molecular weight confirmation, and amino acid analysis for sequence verification. Third-party testing by ISO 17025-accredited laboratories provides independent validation.

• Production Process: Fmoc/tBu SPPS on Rink amide resin, with HBTU/HOBt coupling reagents and TFA cleavage cocktail (95% TFA, 2.5% TIS, 2.5% water).
• Purification: Preparative HPLC using C18 columns (10 μm, 300 Å) with a gradient of acetonitrile/water/0.1% TFA, achieving ≥98% purity.
• Third-Party Testing: Each batch includes a Certificate of Analysis (CoA) with HPLC chromatogram, MS spectrum, endotoxin test (LAL method), and bioburden analysis.
• Certifications: ISO 9001:2015 for quality management, GMP compliance for cosmetic-grade peptides, and REACH registration for EU distribution.
• Stability Studies: Accelerated stability testing at 40°C/75% RH for 6 months confirms no significant degradation (≤2% impurity increase).

Commercial Application Scenarios

High b type natriuretic peptide serves diverse B2B applications. In cosmetic formulation, it is incorporated into anti-aging serums at 0.01-0.1% concentration, targeting inflammation reduction and collagen synthesis. For lab research, BNP is used as a biomarker standard in ELISA kits for heart failure diagnostics. Bulk wholesale buyers typically order 1-100 grams for preclinical studies or large-scale formulation trials.

• Cosmetic Formulation: BNP enhances dermal fibroblast activity, reducing oxidative stress markers (e.g., MMP-1) by up to 45% in vitro. Formulators combine it with hyaluronic acid for synergistic hydration.
• Lab Research: As a positive control in natriuretic peptide assays, BNP ensures accurate quantification in plasma samples. Researchers use it for receptor binding studies (IC50 determination).
• Bulk Wholesale: Custom packaging (1g, 5g, 10g vials) with lyophilized powder, shipped on dry ice. Minimum order quantities (MOQ) start at 100 mg for research-grade material.

high b type natriuretic peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing high b type natriuretic peptide in bulk, buyers must avoid common pitfalls such as accepting low-purity material without third-party validation or ignoring storage requirements. Selection standards include verifying the supplier’s manufacturing certifications, requesting a CoA for each batch, and confirming peptide solubility in your intended buffer. A buyer checklist ensures due diligence.

• Common Pitfalls: Purchasing from unverified suppliers who offer BNP at <$50/mg (indicative of low purity or incorrect sequence). Always request a sample for in-house testing.
• Selection Standards: Require HPLC purity ≥98%, MS confirmation, and endotoxin testing. For cosmetic use, ensure GMP compliance and stability data at 4°C and 25°C.
• Buyer Checklist: (1) Verify supplier’s ISO 9001 certificate; (2) Request CoA with HPLC and MS data; (3) Confirm MOQ and lead time (typically 2-4 weeks); (4) Check shipping conditions (dry ice for international orders).

Core Product Advantages

Our high b type natriuretic peptide offers distinct benefits for B2B clients. Purity of ≥98% ensures minimal interference in sensitive assays, while stability testing guarantees performance over extended storage. Cost performance is optimized through bulk pricing tiers (e.g., $120/mg for 1g orders vs. $180/mg for 100mg). Technical support includes custom reconstitution protocols and application notes for cosmetic formulation.

• Purity: Each batch is double-validated by HPLC and MS, with impurities identified and quantified. This reduces variability in research outcomes.
• Stability: Lyophilized powder maintains >95% purity after 24 months at -20°C, with accelerated studies confirming robustness.
• Cost Performance: Volume discounts up to 40% for orders over 10g, with free shipping for orders >$5,000. No hidden fees for CoA or custom packaging.
• Technical Support: Dedicated peptide specialists provide guidance on reconstitution, storage, and assay compatibility. Custom sequences (e.g., biotinylated BNP) available on request.

Frequently Asked Questions

Q1: What is the typical lead time for bulk orders of high b type natriuretic peptide?
Lead time is 2-4 weeks for standard orders (1-10g), depending on current production schedule. Rush orders (5-7 days) are available at a 20% surcharge. All orders include a CoA and are shipped on dry ice via express courier.

Q2: How do I verify the purity of high b type natriuretic peptide upon receipt?
Request the CoA from your supplier, which includes an HPLC chromatogram showing the main peak at retention time 12.5-13.5 minutes (C18 column, 30-60% acetonitrile gradient). For independent verification, send a sample to a third-party lab for HPLC and MS analysis.

Q3: Can high b type natriuretic peptide be used in cosmetic formulations without further purification?
Yes, if the peptide is GMP-grade and endotoxin-tested (≤1.0 EU/mg). For cosmetic use, ensure the supplier provides stability data in formulation bases (e.g., water-in-oil emulsions). Always conduct a patch test before full-scale production.